PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g098450.1
Common NameMTR_1g098450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 319aa    MW: 37070.7 Da    PI: 8.3843
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g098450.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.71.3e-102492876199
                      E-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3  61 ltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      + +GWk+Fv +n+Lk+gD++vF+l++  +  + v +fr+
  Medtr1g098450.1 249 FCDGWKNFVTDNKLKQGDVCVFQLVEAPRLFFEVVIFRA 287
                      458********************9988666577777775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.3E-11205287IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.12E-14206289IPR015300DNA-binding pseudobarrel domain
CDDcd100173.88E-11207286No hitNo description
SMARTSM010190.0041209288IPR003340B3 DNA binding domain
PfamPF023626.0E-8249287IPR003340B3 DNA binding domain
PROSITE profilePS508639.686252288IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MIFQVSESDT KFCKIIDEDC LGNDDLMITA LSSKFWDYIS SPVCLQLPDK TTWLLDWKQH  60
DDTHVLFNKW KAFAEPHIYP INIFNLSIFD ETDTEIEYPM LSSLFSPWET KTTKPAVSLY  120
HLNRMKKTNQ QEEPKGYLSL LAEICGQSPS QMTMPVEYAD FYTANPKKRG RRREVPYNTR  180
GSSTMKQRKV LGTGALERAK ACCSHIKSFI RQMRPSHIQR NVLVIPRNFL TTRQQQESAM  240
FWIVEAKRFC DGWKNFVTDN KLKQGDVCVF QLVEAPRLFF EVVIFRAREQ STPPHIQGTF  300
DLLQSNLQFL MHTYILAP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1509781e-158AC150978.15 Medicago truncatula clone mth2-66m17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003592074.10.0B3 DNA-binding domain protein
TrEMBLG7IBX10.0G7IBX1_MEDTR; B3 DNA-binding domain protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-07B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]